fayettevillefarmersmarketcny.com valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
# Squarespace Robots Txt User-agent: AdsBot-Google Disallow: /config Disallow: /search Disallow: /account$ Disallow: /account/ Disallow: /commerce/digital-download/ Disallow: /api/ Allow: /api/ui-extensions/ Disallow: /static/ Disallow:/*?author=* Disallow:/*&author=* Disallow:/*?tag=* Disallow:/*&tag=* Disallow:/*?month=* Disallow:/*&month=* Disallow:/*?view=* Disallow:/*&view=* Disallow:/*?format=json Disallow:/*&format=json Disallow:/*?format=page-context Disallow:/*&format=page-context Disallow:/*?format=main-content Disallow:/*&format=main-content Disallow:/*?format=json-pretty Disallow:/*&format=json-pretty Disallow:/*?format=ical Disallow:/*&format=ical Disallow:/*?reversePaginate=* Disallow:/*&reversePaginate=* User-agent: AdsBot-Google-Mobile Disallow: /config Disallow: /search Disallow: /account$ Disallow: /account/ Disallow: /commerce/digital-download/ Disallow: /api/ Allow: /api/ui-extensions/ Disallow: /static/ Disallow:/*?author=* Disallow:/*&author=* Disallow:/*?tag=* | ||
Meta Tags
| Title | Fayetteville Farmers Market |
| Description | Your Best Source for Locally Grown |
| Keywords | N/A |
Server Information
| WebSite | |
| Host IP | 198.49.23.144 |
| Location | United States |
Related Websites
| Site | Rank |
More to Explore
fayettevillefarmersmarketcny.com Valuation
|
US$5,311,478
Last updated: 2022-09-04 11:34:47
fayettevillefarmersmarketcny.com has Semrush global rank of 1,992,723. fayettevillefarmersmarketcny.com has an estimated worth of US$ 5,311,478, based on its estimated Ads revenue. fayettevillefarmersmarketcny.com receives approximately 612,863 unique visitors each day. Its web server is located in United States, with IP address 198.49.23.144. According to SiteAdvisor, fayettevillefarmersmarketcny.com is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$5,311,478 |
| Daily Ads Revenue | US$4,903 |
| Monthly Ads Revenue | US$147,088 |
| Yearly Ads Revenue | US$1,765,045 |
| Daily Unique Visitors | 40,858 |
| Note: All traffic and earnings values are estimates. | |
DNS Records
| Host | Type | TTL | Data |
| fayettevillefarmersmarketcny.com. 14400 | A | IP: 198.49.23.144 | |
| fayettevillefarmersmarketcny.com. 14400 | A | IP: 198.49.23.145 | |
| fayettevillefarmersmarketcny.com. 14400 | A | IP: 198.185.159.144 | |
| fayettevillefarmersmarketcny.com. 14400 | A | IP: 198.185.159.145 | |
| fayettevillefarmersmarketcny.com. 3600 IN NS | NS | NS Record: dns1.p08.nsone.net. | |
| fayettevillefarmersmarketcny.com. 3600 IN NS | NS | NS Record: dns2.p08.nsone.net. | |
| fayettevillefarmersmarketcny.com. 3600 IN NS | NS | NS Record: dns3.p08.nsone.net. | |
| fayettevillefarmersmarketcny.com. 3600 IN NS | NS | NS Record: dns4.p08.nsone.net. | |
| fayettevillefarmersmarketcny.com. 3600 IN NS | NS | NS Record: ns01.squarespacedns.com. | |
| fayettevillefarmersmarketcny.com. 3600 IN NS | NS | NS Record: ns02.squarespacedns.com. | |
| fayettevillefarmersmarketcny.com. 3600 IN NS | NS | NS Record: ns03.squarespacedns.com. | |
| fayettevillefarmersmarketcny.com. 3600 IN NS | NS | NS Record: ns04.squarespacedns.com. | |
| fayettevillefarmersmarketcny.com. 14400 | MX | MX Record: 0 mail.fayettevillefarmersmarketcny.com. | |
| fayettevillefarmersmarketcny.com. 14400 | TXT | TXT Record: v=spf1 a mx ptr include:bluehost.com ?all |
HtmlToTextCheckTime:2022-09-04 11:34:47
| Home The Vendors News Visit Us Home The Vendors News Visit Us Your Best Source For Locally Grown Food! Learn More Fayetteville Farmers Market CNY The market gives you a chance to meet your local farmers and experience the freshest best tasting products. Get to know your farmers and who grows your food. Everything they sell they produce, so you know it’s the best. So come out and support the local economy and give your taste buds a treat! We are a foods and/or drinks related products only market. About Meet the Farmers. Learn More → Take Action Find us. Find Out How → Back to Top Towne Drive, Fayetteville, NY, 13066 fayettevillefarmersmarketcny@yahoo.com Powered by |
HTTP Headers
HTTP/1.1 301 Moved Permanently Age: 476898 Date: Fri, 17 Dec 2021 09:07:00 GMT Location: https://www.fayettevillefarmersmarketcny.com/ Server: Squarespace Set-Cookie: crumb=BX+Xc0q3pxh0OTU1Y2IzOTA1Njc3ZmFhMjIzNWQ5YjhhOTg5NTE4;Path=/ X-Contextid: rQoa60Qs/EU0bWBKC HTTP/2 200 accept-ranges: bytes age: 461311 content-type: text/html;charset=utf-8 date: Fri, 17 Dec 2021 13:26:48 GMT etag: W/"44f33511aed734a67f5466e0a0e3ae78" expires: Thu, 01 Jan 1970 00:00:00 GMT server: Squarespace set-cookie: crumb=BUdJU6I3aa4MMTYwYWYyYjViZTkyOWQ5NWMzZTQ2NDM1MWM0NTFm;Path=/ strict-transport-security: max-age=0 vary: Accept-Encoding x-content-type-options: nosniff x-contextid: X09KCQje/nHoTs9xk content-length: 11809 |
fayettevillefarmersmarketcny.com Whois Information
Domain Name: FAYETTEVILLEFARMERSMARKETCNY.COM Registry Domain ID: 1840427250_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.tucows.com Registrar URL: http://www.tucows.com Updated Date: 2021-12-11T11:16:30Z Creation Date: 2013-12-26T15:52:11Z Registry Expiry Date: 2022-12-26T15:52:11Z Registrar: Tucows Domains Inc. Registrar IANA ID: 69 Registrar Abuse Contact Email: domainabuse@tucows.com Registrar Abuse Contact Phone: +1.4165350123 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: DNS1.P08.NSONE.NET Name Server: DNS2.P08.NSONE.NET Name Server: DNS3.P08.NSONE.NET Name Server: DNS4.P08.NSONE.NET DNSSEC: unsigned >>> Last update of whois database: 2021-12-25T08:34:57Z <<< |